Thera-SAbDab

MOGAMULIZUMAB

> Structural Summary

Therapeutic	Mogamulizumab
Target	CCR4/CD194
Heavy Chain	EVQLVESGGDLVQPGRSLRLSCAASGFIFSNYGMSWVRQAPGKGLEWVATISSASTYSYYPDSVKGRFTISRDNAKNSLYLQMNSLRVEDTALYYCGRHSDGNFAFGYWGQGTLVTVSS
Light Chain	DVLMTQSPLSLPVTPGEPASISCRSSRNIVHINGDTYLEWYLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSLLPWTFGQGTKVEIK
100% seqID Fv Structure	None
99% seqID Fv Structure	None
95-98% seqID Fv Structure	None

There are currently no PDB structures close in sequence to this therapeutic Fv. Click here to build a model with ABodyBuilder2.

> SAbPred Links

Follow these links to our prediction tools:

Model the variable domain structure with ABodyBuilder2
Test for possible therapeutic developability issues with TAP
Assign canonical forms by sequence with SCALOP
Number the sequences in any numbering scheme with ANARCI: [heavy] [light]

Format	Whole mAb
Isotype	G1
Highest Clinical Trial (Feb '25)	Approved
Estimated Status (Feb '25)	Active
Recorded Developmental Technology	POTELLIGENT Technology
INN Year Proposed	2010
INN Year Recommended	2011
Companies Involved	Amgen, Bristol-Myers Squibb, Kagoshima University Dental School, Kyowa Hakko, Kyowa Hakko Kirin, Ono Pharmaceutical
Conditions Approved	Adult T-cell leukaemia-lymphoma, Cutaneous T-cell lymphoma, Peripheral T-cell lymphoma, Mycosis fungoides, Sezary syndrome, Mycosis fungoides
Conditions Active	Spinal cord disorders
Conditions Discontinued	Non-small cell lung cancer, Asthma, Hypersensitivity, Solid tumours
Notes

Schneider, C., Raybould, M.I.J., Deane, C.M. (2022) SAbDab in the Age of Biotherapeutics: Updates including SAbDab-Nano, the Nanobody Structure Tracker. Nucleic Acids Res. 50(D1):D1368-D1372 [link]

SAbDab paper: Dunbar, J., Krawczyk, K. et al (2014). Nucleic Acids Res. 42. D1140-D1146 [link]

Thera-SAbDab paper: Raybould, M.I.J., Marks, C. et al (2019). Nucleic Acids Res. gkz827 [link]

Our privacy policy