Thera-SAbDab

MOXETUMOMAB

> Structural Summary

Therapeutic	Moxetumomab
Target	SIGLEC2/CD22
Heavy Chain	EVQLVESGGGLVKPGGSLKLSCAASGFAFSIYDMSWVRQTPEKCLEWVAYISSGGGTTYYPDTVKGRFTISRDNAKNTLYLQMSSLKSEDTAMYYCARHSGYGTHWGVLFAYWGQGTLVTVSA
Light Chain	DIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQKPDGTVKLLIYYTSILHSGVPSRFSGSGSGTDYSLTISNLEQEDFATYFCQQGNTLPWTFGCGTKLEI
100% seqID Fv Structure	None
99% seqID Fv Structure	None
95-98% seqID Fv Structure	None

There are currently no PDB structures close in sequence to this therapeutic Fv. Click here to build a model with ABodyBuilder2.

> SAbPred Links

Follow these links to our prediction tools:

Model the variable domain structure with ABodyBuilder2
Test for possible therapeutic developability issues with TAP
Assign canonical forms by sequence with SCALOP
Number the sequences in any numbering scheme with ANARCI: [heavy] [light]

Format	Fv Fusion
Isotype	na
Highest Clinical Trial (Feb '25)	Approved
Estimated Status (Feb '25)	NFD
Recorded Developmental Technology	CAT Phage Display
INN Year Proposed	2009
INN Year Recommended	2010
Companies Involved	National Cancer Institute (USA), AstraZeneca, M. D. Anderson Cancer Center, MedImmune, National Cancer Institute (USA)
Conditions Approved	Hairy cell leukaemia
Conditions Active	na
Conditions Discontinued	Chronic lymphocytic leukaemia, Non-Hodgkin's lymphoma, Precursor B-cell lymphoblastic leukaemia-lymphoma, Precursor cell lymphoblastic leukaemia-lymphoma
Notes	ADC with pasudotox

Schneider, C., Raybould, M.I.J., Deane, C.M. (2022) SAbDab in the Age of Biotherapeutics: Updates including SAbDab-Nano, the Nanobody Structure Tracker. Nucleic Acids Res. 50(D1):D1368-D1372 [link]

SAbDab paper: Dunbar, J., Krawczyk, K. et al (2014). Nucleic Acids Res. 42. D1140-D1146 [link]

Thera-SAbDab paper: Raybould, M.I.J., Marks, C. et al (2019). Nucleic Acids Res. gkz827 [link]

Our privacy policy