| Therapeutic | Trinbelimab |
| Target | RhD/CD240D/RhPI |
| Heavy Chain | QVQLVQSGAEVKKPGSSVKVSCKASGGIFRTYAISWVRQAPGQGLEWMGGIIPMFGTVNYAQKFQGRVTISADKSTSTAYMELSRLRSEDTAVYYCARPPSGGCGGDCSRRGYYYAMDVWGQGTTITVSS |
| Light Chain | QSALTQPASVSGSPGQSITISCSGSSSDVGGYKYVSWYQQHPGKAPQLMIYDVNNRPSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCSSYTSSSTRVFGGGTKLTVL |
| 100% seqID Fv Structure | None |
| 99% seqID Fv Structure | None |
| 95-98% seqID Fv Structure | None |
Follow these links to our prediction tools:
| Format | Whole mAb |
| Isotype | G1 |
| Highest Clinical Trial (Feb '25) | TBC |
| Estimated Status (Feb '25) | Active |
| Recorded Developmental Technology | |
| INN Year Proposed | 2021 |
| INN Year Recommended | 2022 |
| Companies Involved | Bharat Serums and Vaccines |
| Conditions Approved | TBC |
| Conditions Active | TBC |
| Conditions Discontinued | TBC |
| Notes | June '22: Corrected CDRH3 sequence |
Schneider, C., Raybould, M.I.J., Deane, C.M. (2022) SAbDab in the Age of Biotherapeutics: Updates including SAbDab-Nano, the Nanobody Structure Tracker. Nucleic Acids Res. 50(D1):D1368-D1372 [link]
SAbDab paper: Dunbar, J., Krawczyk, K. et al (2014). Nucleic Acids Res. 42. D1140-D1146 [link]
Thera-SAbDab paper: Raybould, M.I.J., Marks, C. et al (2019). Nucleic Acids Res. gkz827 [link]