Thera-SAbDab

UBLITUXIMAB

> Structural Summary

Therapeutic	Ublituximab
Target	MS4A1/CD20
Heavy Chain	QAYLQQSGAELVRPGASVKMSCKASGYTFTSYNMHWVKQTPRQGLEWIGGIYPGNGDTSYNQKFKGKATLTVGKSSSTAYMQLSSLTSEDSAVYFCARYDYNYAMDYWGQGTSVTVSS
Light Chain	QIVLSQSPAILSASPGEKVTMTCRASSSVSYMHWYQQKPGSSPKPWIYATSNLASGVPARFSGSGSGTSYSFTISRVEAEDAATYYCQQWTFNPPTFGGGTRLEIK
100% seqID Fv Structure	None
99% seqID Fv Structure	None
95-98% seqID Fv Structure	None

There are currently no PDB structures close in sequence to this therapeutic Fv. Click here to build a model with ABodyBuilder2.

> SAbPred Links

Follow these links to our prediction tools:

Model the variable domain structure with ABodyBuilder2
Test for possible therapeutic developability issues with TAP
Assign canonical forms by sequence with SCALOP
Number the sequences in any numbering scheme with ANARCI: [heavy] [light]

Format	Whole mAb
Isotype	G1
Highest Clinical Trial (Feb '25)	Approved
Estimated Status (Feb '25)	Active
Recorded Developmental Technology	EMABling Platform
INN Year Proposed	2010
INN Year Recommended	2011
Companies Involved	LFB Biotechnologies, rEVO Biologics, Johns Hopkins University, TG Therapeutics Inc
Conditions Approved	Multiple sclerosis
Conditions Active	Chronic lymphocytic leukaemia, Diffuse large B cell lymphoma, Follicular lymphoma, Mantle-cell lymphoma, Non-Hodgkin's lymphoma
Conditions Discontinued	Neuromyelitis optica
Notes	Rituximab biobetter

Schneider, C., Raybould, M.I.J., Deane, C.M. (2022) SAbDab in the Age of Biotherapeutics: Updates including SAbDab-Nano, the Nanobody Structure Tracker. Nucleic Acids Res. 50(D1):D1368-D1372 [link]

SAbDab paper: Dunbar, J., Krawczyk, K. et al (2014). Nucleic Acids Res. 42. D1140-D1146 [link]

Thera-SAbDab paper: Raybould, M.I.J., Marks, C. et al (2019). Nucleic Acids Res. gkz827 [link]

Our privacy policy